PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G044000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 251aa    MW: 26724.4 Da    PI: 7.1129
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G044000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-1883127147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ +
  Seita.5G044000.1.p  83 RRAFSEEEEERLLAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 127
                         678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.9E-1774135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-1977131IPR009057Homeodomain-like
PROSITE profilePS5129427.73378132IPR017930Myb domain
SMARTSM007178.8E-1682130IPR001005SANT/Myb domain
PfamPF002492.5E-1583127IPR001005SANT/Myb domain
CDDcd001673.80E-894128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MAHEMAAFFG AAPPPPAALA PFRDEQRHRD AADEVYHVDD VEDGDAGHGH GGGGGQGKLC  60
ARGHWRPAED AKLKELLDPR INRRAFSEEE EERLLAAHRA YGNKWALIAR LFPGRTDNAV  120
KNHWHVLMAR KQREQSGALR RRKTSSSSSS SPGPAPPQHY APVVVLHHHH YSGSPPLPFH  180
AAATATAAGA HGVPTEAAAA DTRAYSGGES DESASTCTTD LSLGSAPCFY QSAYNPGYDA  240
APRAAAFAPS A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-147713153107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971549.11e-123PREDICTED: transcriptional activator Myb-like
TrEMBLC5XH761e-96C5XH76_SORBI; Putative uncharacterized protein Sb03g010960
STRINGSb03g010960.14e-96(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-29myb domain protein 105